Shop
 Explore 

She struggled as a young single mom. And that’s exactly why she’s hiring them now.

True

"As a single mom, I never got to get a good job," says Lisa Howard, 28.

Lisa had her son when she was only 16. She was also in foster care at the time, so for more than half her life, she struggled to make a living and take care of her family.

And she's not alone. According to the United States Census Bureau, 27.5% of single moms were jobless in 2016, and those who did work only made an average of $34,500 that year.

Many single moms feel limited in their options, struggling to balance the demands of child care with workplaces that may not always be able to accommodate their unique needs. It can quickly become discouraging, a struggle that Lisa knew all too well.

"If you want your child to be the best they can be, you put them first," she says.

Despite challenges, Lisa didn't give up. And that determination would lead her on a path that would not only transform her family's life, but would allow her to support other families like hers.

My 🌏 #momisbest #shewastryingtokissme #iblockthekisshehe #momnokissespleaseee #cookiekid #cookiemom
A post shared by Mr. Cory (@mrcory) on Sep 14, 2017 at 6:05am PDT

But it wasn't easy. At first, they had to forgo some things many other families take for granted — like a car.

It was a "luxury" Lisa simply couldn't afford, so she and her son had to take the bus everywhere.

Despite that, Cory and Lisa made do as best they could.

Cory, however, wanted to do something big to help his mom— he wanted to make enough money to buy her a car.

He started selling cookies to passersby at a small stand when he was just 6 years old to put that goal within reach. Before long, he and his mom developed the definitive cookie recipe — and they decided to turn that into a fully incorporated business.

Gotta keep moving it the cookie hustle guys.. 👊 #mrcoryscookies @mrcoryscookies #keeppushingforward #yourunstoppable
A post shared by Mr. Cory (@mrcory) on Dec 15, 2016 at 5:24am PST

They called it Mr. Cory's Cookies.

Cory's the CEO of the company and Lisa's the CFO. Considering she was the catalyst for the whole idea, it seems like a fair split. They make a great (and adorable) team.

Cookie Mom please I'm older now no more kisses 😩😳 #cookiesmakeyousmile #cookiemomsaysshewillalwayskissmeevenwhenim50 #kidsanyadvice
A post shared by Mr. Cory (@mrcory) on Nov 27, 2017 at 7:10pm PST

Their company garnered a lot of attention initially, even from talk show hosts. In fact, Ellen DeGeneres had him on her show and surprised him with a new car for his family.

But while his first goal of getting his mom a car was achieved, the duo now had a burgeoning company that still required some special attention.

Both mom and son still had a lot to learn about running a successful business, which they realized when problems with their distribution arose.

Since Mr. Cory's Cookies are made of all-natural ingredients, they don't have a long shelf-life, so their distributor couldn't distribute them as-is. As a result, the manufactured recipe changed and product sales came to a grinding halt.

Cory with Marcus Lemonis. Photo via CNBC.

Thankfully Marcus Lemonis, host of CNBC's "The Profit," came in to help turn things around.

Marcus learned at a young age how to help a business thrive. Now he's using that know-how to help other struggling businesses as part of the reality TV series.

After sampling their product and talking with Cory and Lisa, Marcus agreed to invest in their small company. And while he was incredibly impressed with Cory's maturity and go-getter attitude, it was Lisa's story that inspired him to take on the business.

My ❤️ #cookielove #iminlove #myeverything #shesthereasonforitall
A post shared by Mr. Cory (@mrcory) on Jun 23, 2017 at 11:18pm PDT

Since she had Cory so young and under difficult circumstances, she's always felt like she's been fighting tooth and nail to get the life she wants and, more importantly, deserves for her family.

This business opportunity is giving her a glimpse of what could be possible for her and Cory's future, which is why it's so precious.

It's her chance to reach the goal she's only dreamed of — running a truly successful company and maybe even help other moms like her along the way.

Lisa's long-term hope for Mr. Cory's Cookies is to hire a staff that's 70% single mothers to help give them a leg up.

Cory's mom, Lisa. Photo via CNBC.

"We can help them by giving them a chance," explains Lisa.

This business could be Lisa's opportunity to turn things around for women like her who've been fighting an uphill battle for their families.

Marcus helps Lisa and Cory get Mr. Cory's Cookies back on track, including solving their distribution problems and introducing them to key companies that can help them expand.

But does Lisa end up with her dream staff? Tune-in to The Profit tomorrow at 10PM ET/PT on CNBC to find out.

Can't wait till then? Here's a sneak peak of the upcoming episode.

From Your Site Articles

This mom with a love of demolition is reinventing what it means to be a “homemaker” ›

Joy

Airbnb host wakes his guest up in the middle of the night so she wouldn't miss the northern lights

Best. Host. Ever.

@penslucero/TikTok

Pency Lucero taking in the Northern Lights

Seeing the northern lights is a common bucket list adventure for many people. After all, it ticks a lot of boxes—being a dazzling light show, rich historical experience and scientific phenomenon all rolled into one. Plus there’s the uncertainty of it all, never quite knowing if you’ll witness a vivid streak of otherworldly colors dance across the sky…or simply see an oddly colored cloud. It’s nature’s slot machine, if you will.

Traveler and content creator Pency Lucero was willing to take that gamble. After thorough research, she stumbled upon an Airbnb in Rörbäck, Sweden with an actual picture of the northern lights shining above the cabin in the listing. With that kind of photo evidence, she felt good about her odds.

However, as soon as she landed, snow began falling so hard that the entire sky was “barely visible,” she told Upworthy. Martin, the Airbnb host, was nonetheless determined to do everything he could to ensure his guests got to see the spectacle, even offering to wake Lucero up in the middle of the night if he saw anything.

Then one night, the knock came.

Keep ReadingShow less

nature

Education

Germany's most famous castle isn't a real castle. It's an elaborate 'work of fan fiction.'

Though it looks medieval, it was built in the 19th century by an eccentric "fairy tale king" who spent much of his life constructing his own elaborate fantasy world.

Public Domain

Neuschwanstein Castle sits atop a rock ledge in the Bavarian Alps.

Even if you haven't heard of Neuschwanstein Castle, there's a good chance you've at least seen pictures of it. Set atop a tree-covered rock ledge in the Bavarian Alps, the picturesque castle looks like it was conjured straight out of a fairy tale. In fact, it served as inspiration for Disney Imagineers as they designed "Sleeping Beauty's Castle" in Disneyland, and it's regularly named the top castle to visit in Germany.

There are estimated to be around 25,000 castles in Germany, but Neuschwanstein is unique among them. Most notably, it's not a real castle and never was. While it bears the look and feel of a well-preserved medieval castle, it was actually built in the 19th century, and rather than serving as a fortress, it served as the fantasy castle of an eccentric king obsessed with Richard Wagner's operas and medieval mythology.

Ludwig II came to the Bavarian throne in 1864 at age 18 with no experience in government or politics. Two years later, Prussia conquered Austria and Bavaria, and Ludwig's powerful status as king was greatly diminished. Not that he was particularly interested in governance anyway; he was more drawn to the romantic idea of having his own kingdom.

Keep ReadingShow less

interesting history

Pop Culture

People are loving this Amazon delivery driver for warning a woman that her house is 'unsafe'

Great info, even better delivery.

TikTok

Delivering packages AND safety.

Amazon delivery drivers don’t have the easiest job in the world. Sitting through traffic, working in extreme temperatures, hauling boxes … not exactly a fun time. So when a driver goes out of their way to be extra considerate—people notice.

One delivery driver has gone viral for the way she delivered a little bit of safety education, along with some lighthearted advice. The TikTok video of the encounter, which now has more than 4 million views, was shared by Jessica Huseman, who had only recently moved into her new house.

Keep ReadingShow less

acts of kindness

Science

Conjoined twins with fused brains separated; surgeons practiced for months in virtual reality

Arthur and Bernardo finally get to see each other face to face.

Image by sasint/Canva

Surgeons prepared to separate 3-year-old conjoined twins in Brazil using virtual reality.

The things human beings have figured out how to do boggles the mind sometimes, especially in the realm of medicine.

It wasn't terribly long ago that people with a severe injury had to liquor up, bite a stick, have a body part sewn up or sawed off and hope for the best. (Sorry for the visual, but it's true.) The discoveries of antibiotics and anesthesia alone have completely revolutionized human existence, but we've gone well beyond that with what our best surgeons can accomplish.

Surgeries can range from fairly simple to incredibly complex, but few surgeries are more complicated than separating conjoined twins with combined major organs. That's why the recent surgical separation of conjoined twin boys with fused brains in Brazil is so incredible.

Keep ReadingShow less

Pop Culture

People share the 18 things that are a 'subtle sign' someone is really smart

"They effortlessly communicate complex concepts in a simple way."

via PixaBay

Albert Einstein

One of the strangest things about being human is that people of lesser intelligence tend to overestimate how smart they are and people who are highly intelligent tend to underestimate how smart they are.

This is called the Dunning-Kruger effect and it’s proven every time you log onto Facebook and see someone from high school who thinks they know more about vaccines than a doctor.

The interesting thing is that even though people are poor judges of their own smarts, we’ve evolved to be pretty good at judging the intelligence of others.